Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (21 species) not a true protein |
Species Cellulomonas fimi [TaxId:1708] [231537] (1 PDB entry) |
Domain d2x2yb1: 2x2y B:4-370 [231541] Other proteins in same PDB: d2x2ya2, d2x2yb2 automated match to d2bvta2 complexed with fmt, mg; mutant |
PDB Entry: 2x2y (more details), 2.35 Å
SCOPe Domain Sequences for d2x2yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x2yb1 c.1.8.3 (B:4-370) automated matches {Cellulomonas fimi [TaxId: 1708]} etiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdf pavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsf ydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfww gaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvl gldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkv laaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtgafd rtvaaap
Timeline for d2x2yb1: