Lineage for d2x2yb1 (2x2y B:4-370)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819412Protein automated matches [190057] (21 species)
    not a true protein
  7. 1819458Species Cellulomonas fimi [TaxId:1708] [231537] (1 PDB entry)
  8. 1819460Domain d2x2yb1: 2x2y B:4-370 [231541]
    Other proteins in same PDB: d2x2ya2, d2x2yb2
    automated match to d2bvta2
    complexed with fmt, mg; mutant

Details for d2x2yb1

PDB Entry: 2x2y (more details), 2.35 Å

PDB Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant
PDB Compounds: (B:) man26a

SCOPe Domain Sequences for d2x2yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x2yb1 c.1.8.3 (B:4-370) automated matches {Cellulomonas fimi [TaxId: 1708]}
etiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdf
pavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsf
ydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfww
gaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvl
gldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkv
laaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtgafd
rtvaaap

SCOPe Domain Coordinates for d2x2yb1:

Click to download the PDB-style file with coordinates for d2x2yb1.
(The format of our PDB-style files is described here.)

Timeline for d2x2yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x2yb2