SCOPe 2.03: Domain d2x2yb1: 2x2y B:4-370

Lineage for d2x2yb1 (2x2y B:4-370)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (15 species)
   not a true protein

7. Species Cellulomonas fimi [TaxId:1708] [231537] (1 PDB entry)

8. Domain d2x2yb1: 2x2y B:4-370 [231541]
   Other proteins in same PDB: d2x2ya2, d2x2yb2
   automated match to d2bvta2
   complexed with fmt, mg; mutant

Details for d2x2yb1

PDB Entry: 2x2y, 2.35 Å

PDB Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant

PDB Compounds: (B:) man26a

SCOPe Domain Sequences for d2x2yb1:

Sequence; same for both SEQRES and ATOM records:

>d2x2yb1 c.1.8.3 (B:4-370) automated matches {Cellulomonas fimi [TaxId: 1708]}
etiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdf
pavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsf
ydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfww
gaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvl
gldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkv
laaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtgafd
rtvaaap

Timeline for d2x2yb1:

• d2x2yb1 is new in SCOPe 2.03-stable
  
• d2x2yb1 appears in SCOPe 2.04
  
• d2x2yb1 appears in the current release, SCOPe 2.08