Lineage for d2wvcb2 (2wvc B:61-148)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653844Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1654045Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 1654046Protein automated matches [226892] (5 species)
    not a true protein
  7. 1654070Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)
  8. 1654078Domain d2wvcb2: 2wvc B:61-148 [231508]
    Other proteins in same PDB: d2wvca1, d2wvcb1
    automated match to d2bj9a2
    complexed with fmt, gol, so4

Details for d2wvcb2

PDB Entry: 2wvc (more details), 2.1 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function
PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wvcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvcb2 d.58.18.0 (B:61-148) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydggqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassfeyne

SCOPe Domain Coordinates for d2wvcb2:

Click to download the PDB-style file with coordinates for d2wvcb2.
(The format of our PDB-style files is described here.)

Timeline for d2wvcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wvcb1