SCOPe 2.08: Domain d1aspb3: 1asp B:339-552

Lineage for d1aspb3 (1asp B:339-552)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Ascorbate oxidase, C-terminal domain [418904] (1 species)
   protein consists of three domains of this fold
7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419306] (4 PDB entries)

8. Domain d1aspb3: 1asp B:339-552 [23147]
   Other proteins in same PDB: d1aspa1, d1aspa2, d1aspb1, d1aspb2
   complexed with cu, nag, oh, peo
   has additional insertions and/or extensions that are not grouped together

Details for d1aspb3

PDB Entry: 1asp, 2.59 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

PDB Compounds: (B:) ascorbate oxidase

SCOPe Domain Sequences for d1aspb3:

Sequence; same for both SEQRES and ATOM records:

>d1aspb3 b.6.1.3 (B:339-552) Ascorbate oxidase, C-terminal domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

Timeline for d1aspb3:

• d1aspb3 first appeared (with stable ids) in SCOP 1.55
  
• d1aspb3 appears in SCOPe 2.07