![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Ascorbate oxidase, N-terminal domain [418902] (1 species) protein consists of three domains of this fold |
![]() | Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419304] (4 PDB entries) |
![]() | Domain d1aspb1: 1asp B:1-129 [23145] Other proteins in same PDB: d1aspa2, d1aspa3, d1aspb2, d1aspb3 complexed with cu, nag, oh, peo |
PDB Entry: 1asp (more details), 2.59 Å
SCOPe Domain Sequences for d1aspb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aspb1 b.6.1.3 (B:1-129) Ascorbate oxidase, N-terminal domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli vdppqgkke
Timeline for d1aspb1: