Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
Protein automated matches [231410] (2 species) not a true protein |
Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries) |
Domain d2wl5a1: 2wl5 A:4-268 [231425] Other proteins in same PDB: d2wl5a2, d2wl5b2, d2wl5c2, d2wl5d2 automated match to d1qfla1 complexed with cl, coa, dno, na, so4; mutant |
PDB Entry: 2wl5 (more details), 1.8 Å
SCOPe Domain Sequences for d2wl5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl5a1 c.95.1.1 (A:4-268) automated matches {Zoogloea ramigera [TaxId: 350]} siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta gnasglndgaaaallmseaeasrrg
Timeline for d2wl5a1: