Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (9 species) not a true protein |
Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries) |
Domain d2we3a1: 2we3 A:1-115 [231393] automated match to d2bsya1 complexed with dut, mg, so4; mutant |
PDB Entry: 2we3 (more details), 2 Å
SCOPe Domain Sequences for d2we3a1:
Sequence, based on SEQRES records: (download)
>d2we3a1 b.85.4.1 (A:1-115) automated matches {Human herpesvirus 4 [TaxId: 10377]} meacphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglml wgstsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpq
>d2we3a1 b.85.4.1 (A:1-115) automated matches {Human herpesvirus 4 [TaxId: 10377]} meacphiryafqndklllqqgrltlvnkttillrpmktttvdlglyarppeghglmlwgs tsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpq
Timeline for d2we3a1: