Lineage for d2we3a1 (2we3 A:1-115)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083305Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2083459Protein automated matches [190798] (8 species)
    not a true protein
  7. 2083466Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries)
  8. 2083473Domain d2we3a1: 2we3 A:1-115 [231393]
    automated match to d2bsya1
    complexed with dut, mg, so4; mutant

Details for d2we3a1

PDB Entry: 2we3 (more details), 2 Å

PDB Description: ebv dutpase inactive mutant deleted of motif v
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2we3a1:

Sequence, based on SEQRES records: (download)

>d2we3a1 b.85.4.1 (A:1-115) automated matches {Human herpesvirus 4 [TaxId: 10377]}
meacphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglml
wgstsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpq

Sequence, based on observed residues (ATOM records): (download)

>d2we3a1 b.85.4.1 (A:1-115) automated matches {Human herpesvirus 4 [TaxId: 10377]}
meacphiryafqndklllqqgrltlvnkttillrpmktttvdlglyarppeghglmlwgs
tsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpq

SCOPe Domain Coordinates for d2we3a1:

Click to download the PDB-style file with coordinates for d2we3a1.
(The format of our PDB-style files is described here.)

Timeline for d2we3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2we3a2