SCOPe 2.03: Domain d2we2a2: 2we2 A:121-256

Lineage for d2we2a2 (2we2 A:121-256)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries)

8. Domain d2we2a2: 2we2 A:121-256 [231392]
   automated match to d2bsya2
   complexed with so4, ump; mutant

Details for d2we2a2

PDB Entry: 2we2, 1.5 Å

PDB Description: ebv dutpase double mutant gly78asp-asp131ser with dump

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2we2a2:

Sequence; same for both SEQRES and ATOM records:

>d2we2a2 b.85.4.1 (A:121-256) automated matches {Human herpesvirus 4 [TaxId: 10377]}
gpinhpqypgsvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

Timeline for d2we2a2:

• d2we2a2 is new in SCOPe 2.03-stable
  
• d2we2a2 appears in SCOPe 2.04
  
• d2we2a2 appears in the current release, SCOPe 2.08