Lineage for d2bsya2 (2bsy A:121-256)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332445Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1332593Protein Monomeric viral dUTPase [141655] (1 species)
    related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sites
  7. 1332594Species Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries)
    Uniprot P03195 121-256! Uniprot P03195 4-116
    Human herpesvirus 4
  8. 1332596Domain d2bsya2: 2bsy A:121-256 [129130]
    includes domain 2, rudiment domain 3 and C-terminal arm
    complexed with so4, ump

Details for d2bsya2

PDB Entry: 2bsy (more details), 1.5 Å

PDB Description: epstein barr virus dutpase
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2bsya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]}
gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

SCOPe Domain Coordinates for d2bsya2:

Click to download the PDB-style file with coordinates for d2bsya2.
(The format of our PDB-style files is described here.)

Timeline for d2bsya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bsya1