SCOPe 2.08: Domain d2bsya2: 2bsy A:121-256

Lineage for d2bsya2 (2bsy A:121-256)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Monomeric viral dUTPase [141655] (1 species)
   related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sites

7. Species Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries)
   Uniprot P03195 121-256! Uniprot P03195 4-116
   Human herpesvirus 4

8. Domain d2bsya2: 2bsy A:121-256 [129130]
   includes domain 2, rudiment domain 3 and C-terminal arm
   complexed with so4, ump

Details for d2bsya2

PDB Entry: 2bsy, 1.5 Å

PDB Description: epstein barr virus dutpase

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2bsya2:

Sequence; same for both SEQRES and ATOM records:

>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]}
gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

Timeline for d2bsya2:

• d2bsya2 first appeared in SCOP 1.73
  
• d2bsya2 appears in SCOPe 2.07