![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein automated matches [190798] (8 species) not a true protein |
![]() | Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries) |
![]() | Domain d2we0a2: 2we0 A:121-256 [231388] automated match to d2bsya2 complexed with so4, teo, ump; mutant |
PDB Entry: 2we0 (more details), 2.01 Å
SCOPe Domain Sequences for d2we0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2we0a2 b.85.4.1 (A:121-256) automated matches {Human herpesvirus 4 [TaxId: 10377]} gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl frwasctfeevpslam
Timeline for d2we0a2: