Lineage for d2we0a2 (2we0 A:121-256)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560651Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1560805Protein automated matches [190798] (8 species)
    not a true protein
  7. 1560812Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries)
  8. 1560818Domain d2we0a2: 2we0 A:121-256 [231388]
    automated match to d2bsya2
    complexed with so4, teo, ump; mutant

Details for d2we0a2

PDB Entry: 2we0 (more details), 2.01 Å

PDB Description: ebv dutpase mutant cys4ser
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2we0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2we0a2 b.85.4.1 (A:121-256) automated matches {Human herpesvirus 4 [TaxId: 10377]}
gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

SCOPe Domain Coordinates for d2we0a2:

Click to download the PDB-style file with coordinates for d2we0a2.
(The format of our PDB-style files is described here.)

Timeline for d2we0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2we0a1