Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Monomeric viral dUTPase [141655] (1 species) related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sites |
Species Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries) Uniprot P03195 121-256! Uniprot P03195 4-116 Human herpesvirus 4 |
Domain d2bsya2: 2bsy A:121-256 [129130] includes domain 2, rudiment domain 3 and C-terminal arm complexed with so4, ump |
PDB Entry: 2bsy (more details), 1.5 Å
SCOPe Domain Sequences for d2bsya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]} gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl frwasctfeevpslam
Timeline for d2bsya2: