SCOPe 2.08: Domain d2uyyd2: 2uyy D:430-553

Lineage for d2uyyd2 (2uyy D:430-553)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)

8. Domain d2uyyd2: 2uyy D:430-553 [231337]
   Other proteins in same PDB: d2uyya1, d2uyyb1, d2uyyc1, d2uyyd1
   automated match to d3ckya2
   complexed with k, na7

Details for d2uyyd2

PDB Entry: 2uyy, 2.5 Å

PDB Description: structure of the cytokine-like nuclear factor n-pac

PDB Compounds: (D:) n-pac protein

SCOPe Domain Sequences for d2uyyd2:

Sequence; same for both SEQRES and ATOM records:

>d2uyyd2 a.100.1.0 (D:430-553) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqni
lqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyr
ayih

Timeline for d2uyyd2:

• d2uyyd2 first appeared in SCOPe 2.03
  
• d2uyyd2 appears in SCOPe 2.07