PDB entry 2uyy

View 2uyy on RCSB PDB site
Description: structure of the cytokine-like nuclear factor n-pac
Class: cytokine
Keywords: long-chain dehydrogenase, cytokine
Deposited on 2007-04-20, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-pac protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYY
    • Uniprot Q6P1Q2 (Start-315)
    Domains in SCOPe 2.07: d2uyya1, d2uyya2
  • Chain 'B':
    Compound: n-pac protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYY
    • Uniprot Q6P1Q2 (Start-315)
    Domains in SCOPe 2.07: d2uyyb1, d2uyyb2
  • Chain 'C':
    Compound: n-pac protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYY
    • Uniprot Q6P1Q2 (Start-315)
    Domains in SCOPe 2.07: d2uyyc1, d2uyyc2
  • Chain 'D':
    Compound: n-pac protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UYY
    • Uniprot Q6P1Q2 (Start-315)
    Domains in SCOPe 2.07: d2uyyd1, d2uyyd2
  • Heterogens: K, NA7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uyyA (A:)
    mhhhhhhssgvdlgtenlyfqsmgsitptdkkigflglglmgsgivsnllkmghtvtvwn
    rtaekcdlfiqegarlgrtpaevvstcditfacvsdpkaakdlvlgpsgvlqgirpgkcy
    vdmstvdadtvtelaqvivsrggrfleapvsgnqqlsndgmlvilaagdrglyedcsscf
    qamgktsfflgevgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgql
    asifldqkcqnilqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakal
    dqsdndmsavyrayih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyyA (A:)
    sitptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevv
    stcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggr
    fleapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflgevgnaakmmlivn
    mvqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqnilqgnfkpdfylk
    yiqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyrayih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uyyB (B:)
    mhhhhhhssgvdlgtenlyfqsmgsitptdkkigflglglmgsgivsnllkmghtvtvwn
    rtaekcdlfiqegarlgrtpaevvstcditfacvsdpkaakdlvlgpsgvlqgirpgkcy
    vdmstvdadtvtelaqvivsrggrfleapvsgnqqlsndgmlvilaagdrglyedcsscf
    qamgktsfflgevgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgql
    asifldqkcqnilqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakal
    dqsdndmsavyrayih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyyB (B:)
    sitptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevv
    stcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggr
    fleapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflgevgnaakmmlivn
    mvqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqnilqgnfkpdfylk
    yiqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyrayih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2uyyC (C:)
    mhhhhhhssgvdlgtenlyfqsmgsitptdkkigflglglmgsgivsnllkmghtvtvwn
    rtaekcdlfiqegarlgrtpaevvstcditfacvsdpkaakdlvlgpsgvlqgirpgkcy
    vdmstvdadtvtelaqvivsrggrfleapvsgnqqlsndgmlvilaagdrglyedcsscf
    qamgktsfflgevgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgql
    asifldqkcqnilqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakal
    dqsdndmsavyrayih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyyC (C:)
    sitptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevv
    stcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggr
    fleapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflgevgnaakmmlivn
    mvqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqnilqgnfkpdfylk
    yiqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyrayih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2uyyD (D:)
    mhhhhhhssgvdlgtenlyfqsmgsitptdkkigflglglmgsgivsnllkmghtvtvwn
    rtaekcdlfiqegarlgrtpaevvstcditfacvsdpkaakdlvlgpsgvlqgirpgkcy
    vdmstvdadtvtelaqvivsrggrfleapvsgnqqlsndgmlvilaagdrglyedcsscf
    qamgktsfflgevgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgql
    asifldqkcqnilqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakal
    dqsdndmsavyrayih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uyyD (D:)
    itptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevvs
    tcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggrf
    leapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflgevgnaakmmlivnm
    vqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqnilqgnfkpdfylky
    iqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyrayih