SCOPe 2.04: Domain d2r5aa2: 2r5a A:282-385

Lineage for d2r5aa2 (2r5a A:282-385)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (3 PDB entries)

8. Domain d2r5aa2: 2r5a A:282-385 [231245]
   automated match to d1oi1a2
   complexed with mlz

Details for d2r5aa2

PDB Entry: 2r5a, 2.3 Å

PDB Description: crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with methyl lysine

PDB Compounds: (A:) Polycomb protein Scm

SCOPe Domain Sequences for d2r5aa2:

Sequence; same for both SEQRES and ATOM records:

>d2r5aa2 b.34.9.0 (A:282-385) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
swpgylckilnnamvapeeifqpeppepeenlfkvgqkleavdkknpqliccatvdaikd
dqihvtfdgwrgafdywcnyrsrdifpagwcarschpmqppghk

Timeline for d2r5aa2:

• d2r5aa2 first appeared in SCOPe 2.03
  
• d2r5aa2 appears in SCOPe 2.05
  
• d2r5aa2 appears in the current release, SCOPe 2.08