Lineage for d2qrce1 (2qrc E:3-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943405Protein automated matches [190627] (7 species)
    not a true protein
  7. 2943406Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries)
  8. 2943415Domain d2qrce1: 2qrc E:3-181 [231221]
    Other proteins in same PDB: d2qrca_, d2qrcb_, d2qrcc_, d2qrcd_, d2qrcg3
    automated match to d2ooxe1
    complexed with adp, amp

Details for d2qrce1

PDB Entry: 2qrc (more details), 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP
PDB Compounds: (E:) Protein C1556.08c

SCOPe Domain Sequences for d2qrce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrce1 d.37.1.1 (E:3-181) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplwd
seankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiyv
hpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr

SCOPe Domain Coordinates for d2qrce1:

Click to download the PDB-style file with coordinates for d2qrce1.
(The format of our PDB-style files is described here.)

Timeline for d2qrce1: