Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Nitric oxide reductase C-terminal domain [142047] (2 species) |
Species Giardia intestinalis [TaxId:5741] [231193] (1 PDB entry) |
Domain d2q9ua2: 2q9u A:254-412 [231194] Other proteins in same PDB: d2q9ua1, d2q9ub1 automated match to d1ycfa1 complexed with feo, fmn, no3 |
PDB Entry: 2q9u (more details), 1.9 Å
SCOPe Domain Sequences for d2q9ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9ua2 c.23.5.1 (A:254-412) Nitric oxide reductase C-terminal domain {Giardia intestinalis [TaxId: 5741]} hcqkkvtvvldsmygtthrmalalldgarstgcetvllemtssditkvalhtydsgavaf asptlnntmmpsvaaalnyvrgltlikgkpafafgafgwsnravpdivaelrdgckadvy dekgitfkfnyteelleqaynagvdlgkraiayceknap
Timeline for d2q9ua2: