SCOPe 2.05: Domain d2q9ub2: 2q9u B:254-412

Lineage for d2q9ub2 (2q9u B:254-412)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Nitric oxide reductase C-terminal domain [142047] (2 species)

7. Species Giardia intestinalis [TaxId:5741] [231193] (1 PDB entry)

8. Domain d2q9ub2: 2q9u B:254-412 [231196]
   Other proteins in same PDB: d2q9ua1, d2q9ub1
   automated match to d1ycfa1
   complexed with feo, fmn, no3

Details for d2q9ub2

PDB Entry: 2q9u, 1.9 Å

PDB Description: Crystal structure of the flavodiiron protein from Giardia intestinalis

PDB Compounds: (B:) A-type flavoprotein

SCOPe Domain Sequences for d2q9ub2:

Sequence; same for both SEQRES and ATOM records:

>d2q9ub2 c.23.5.1 (B:254-412) Nitric oxide reductase C-terminal domain {Giardia intestinalis [TaxId: 5741]}
hcqkkvtvvldsmygtthrmalalldgarstgcetvllemtssditkvalhtydsgavaf
asptlnntmmpsvaaalnyvrgltlikgkpafafgafgwsnravpdivaelrdgckadvy
dekgitfkfnyteelleqaynagvdlgkraiayceknap

Timeline for d2q9ub2:

• d2q9ub2 first appeared in SCOPe 2.03
  
• d2q9ub2 appears in SCOPe 2.04
  
• d2q9ub2 appears in SCOPe 2.06
  
• d2q9ub2 appears in the current release, SCOPe 2.08