Lineage for d2q9ua2 (2q9u A:254-412)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587350Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1587438Protein Nitric oxide reductase C-terminal domain [142047] (2 species)
  7. 1587439Species Giardia intestinalis [TaxId:5741] [231193] (1 PDB entry)
  8. 1587440Domain d2q9ua2: 2q9u A:254-412 [231194]
    Other proteins in same PDB: d2q9ua1, d2q9ub1
    automated match to d1ycfa1
    complexed with feo, fmn, no3

Details for d2q9ua2

PDB Entry: 2q9u (more details), 1.9 Å

PDB Description: Crystal structure of the flavodiiron protein from Giardia intestinalis
PDB Compounds: (A:) A-type flavoprotein

SCOPe Domain Sequences for d2q9ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9ua2 c.23.5.1 (A:254-412) Nitric oxide reductase C-terminal domain {Giardia intestinalis [TaxId: 5741]}
hcqkkvtvvldsmygtthrmalalldgarstgcetvllemtssditkvalhtydsgavaf
asptlnntmmpsvaaalnyvrgltlikgkpafafgafgwsnravpdivaelrdgckadvy
dekgitfkfnyteelleqaynagvdlgkraiayceknap

SCOPe Domain Coordinates for d2q9ua2:

Click to download the PDB-style file with coordinates for d2q9ua2.
(The format of our PDB-style files is described here.)

Timeline for d2q9ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q9ua1