SCOPe 2.08: Domain d1ndsb2: 1nds B:167-340

Lineage for d1ndsb2 (1nds B:167-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries)
   Uniprot O68601

8. Domain d1ndsb2: 1nds B:167-340 [23115]
   Other proteins in same PDB: d1ndsa1, d1ndsb1, d1ndsc1
   CA-atoms only
   complexed with cu, no2
   has additional insertions and/or extensions that are not grouped together

Details for d1ndsb2

PDB Entry: 1nds, 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1ndsb2:

Sequence; same for both SEQRES and ATOM records:

>d1ndsb2 b.6.1.3 (B:167-340) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
gaalaydrvytigesdlyvpkaadgnysdypalasayadtvavmrtltpshavfngavga
ltganaltaavgesvliihsqanrdsrphligghgdwvwttgkfanppqlnmetwfipgg
saaaalytfkqpgtyaylshnlieamelgaaaqasvegqwdddlmtsvaapgpa

Timeline for d1ndsb2:

• d1ndsb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ndsb2 appears in SCOPe 2.07