Lineage for d2oqha1 (2oqh A:2-122)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649720Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)
  8. 1649721Domain d2oqha1: 2oqh A:2-122 [231095]
    Other proteins in same PDB: d2oqha2, d2oqhb2, d2oqhc2, d2oqhd2
    automated match to d2p8ba1
    complexed with so4

Details for d2oqha1

PDB Entry: 2oqh (more details), 1.98 Å

PDB Description: crystal structure of an isomerase from streptomyces coelicolor a3(2)
PDB Compounds: (A:) Putative isomerase

SCOPe Domain Sequences for d2oqha1:

Sequence, based on SEQRES records: (download)

>d2oqha1 d.54.1.0 (A:2-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
slkitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivr
rmapdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllg
g

Sequence, based on observed residues (ATOM records): (download)

>d2oqha1 d.54.1.0 (A:2-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
slkitdvdvwvvnlplvnpfgetrtvvrvrtdsgvegwgetmwgapvaaivrrmapdlig
tspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllgg

SCOPe Domain Coordinates for d2oqha1:

Click to download the PDB-style file with coordinates for d2oqha1.
(The format of our PDB-style files is described here.)

Timeline for d2oqha1: