| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries) |
| Domain d2oqha1: 2oqh A:4-122 [231095] Other proteins in same PDB: d2oqha2, d2oqha3, d2oqhb2, d2oqhb3, d2oqhc2, d2oqhc3, d2oqhd2, d2oqhd3 automated match to d2p8ba1 complexed with so4 |
PDB Entry: 2oqh (more details), 1.98 Å
SCOPe Domain Sequences for d2oqha1:
Sequence, based on SEQRES records: (download)
>d2oqha1 d.54.1.0 (A:4-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
kitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivrrm
apdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllgg
>d2oqha1 d.54.1.0 (A:4-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
kitdvdvwvvnlplvnpfgetrtvvrvrtdsgvegwgetmwgapvaaivrrmapdligts
pfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllgg
Timeline for d2oqha1: