Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries) Uniprot O68601 |
Domain d1ndta1: 1ndt A:1-159 [23108] Other proteins in same PDB: d1ndta2 complexed with cl, cu |
PDB Entry: 1ndt (more details), 2.1 Å
SCOPe Domain Sequences for d1ndta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndta1 b.6.1.3 (A:1-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]} adadslphtkvtlvappqvhpheqatasgpkvteftmtieekkmviddsgttlqamtfng smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka drsgtfvyhcapsgmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d1ndta1: