| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
| Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries) Uniprot O68601 |
| Domain d1ndta2: 1ndt A:160-336 [23109] Other proteins in same PDB: d1ndta1 complexed with cl, cu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ndt (more details), 2.1 Å
SCOPe Domain Sequences for d1ndta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndta2 b.6.1.3 (A:160-336) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
agaplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltasvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghisvegkwnddlmkqikapapipa
Timeline for d1ndta2: