![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
![]() | Protein automated matches [190158] (24 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries) |
![]() | Domain d2ohia2: 2ohi A:255-403 [231074] Other proteins in same PDB: d2ohia1, d2ohib1, d2ohid1, d2ohie1, d2ohig1, d2ohih1, d2ohii1, d2ohij1 automated match to d1ycfa1 complexed with cl, fe, fmn |
PDB Entry: 2ohi (more details), 2.3 Å
SCOPe Domain Sequences for d2ohia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohia2 c.23.5.0 (A:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva ceeevyyvptgdeldacfeagrklaaeir
Timeline for d2ohia2: