Lineage for d1as7c2 (1as7 C:167-340)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries)
    Uniprot P38501
  8. Domain d1as7c2: 1as7 C:167-340 [23107]
    Other proteins in same PDB: d1as7a1, d1as7b1, d1as7c1
    complexed with cu
    has additional insertions and/or extensions that are not grouped together

Details for d1as7c2

PDB Entry: 1as7 (more details), 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase at cryo temperature
PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1as7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as7c2 b.6.1.3 (C:167-340) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt

SCOPe Domain Coordinates for d1as7c2 are not available.

Timeline for d1as7c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1as7c1
View in 3D
Domains from other chains:
(mouse over for more information)
d1as7a1, d1as7a2, d1as7b1, d1as7b2