![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries) Uniprot P38501 |
![]() | Domain d1as7b2: 1as7 B:167-340 [23105] Other proteins in same PDB: d1as7a1, d1as7b1, d1as7c1 complexed with cu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1as7 (more details), 2 Å
SCOPe Domain Sequences for d1as7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1as7b2 b.6.1.3 (B:167-340) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
Timeline for d1as7b2:
![]() Domains from other chains: (mouse over for more information) d1as7a1, d1as7a2, d1as7c1, d1as7c2 |