Lineage for d2ivgf2 (2ivg F:87-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957542Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2957543Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2957544Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 2957567Protein automated matches [230795] (1 species)
    not a true protein
  7. 2957568Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. 2957574Domain d2ivgf2: 2ivg F:87-156 [230843]
    Other proteins in same PDB: d2ivga1, d2ivgb1, d2ivgc1, d2ivgd1, d2ivge1, d2ivgf1, d2ivgg1, d2ivgh1, d2ivgi1, d2ivgj1
    automated match to d1dwka2
    complexed with azi, cl, so4

Details for d2ivgf2

PDB Entry: 2ivg (more details), 1.87 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (F:) cyanate lyase

SCOPe Domain Sequences for d2ivgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivgf2 d.72.1.1 (F:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkygptkpf

SCOPe Domain Coordinates for d2ivgf2:

Click to download the PDB-style file with coordinates for d2ivgf2.
(The format of our PDB-style files is described here.)

Timeline for d2ivgf2: