PDB entry 2ivg

View 2ivg on RCSB PDB site
Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
Class: lyase
Keywords: midwest center for structural genomics, protein structure initiative, psi, mcsg, lyase, cyanate degradation
Deposited on 2006-06-13, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.147
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivga1, d2ivga2
  • Chain 'B':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgb1, d2ivgb2
  • Chain 'C':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgc1, d2ivgc2
  • Chain 'D':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgd1, d2ivgd2
  • Chain 'E':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivge1, d2ivge2
  • Chain 'F':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgf1, d2ivgf2
  • Chain 'G':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgg1, d2ivgg2
  • Chain 'H':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgh1, d2ivgh2
  • Chain 'I':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgi1, d2ivgi2
  • Chain 'J':
    Compound: cyanate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d2ivgj1, d2ivgj2
  • Heterogens: CL, SO4, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgA (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgB (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgC (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgD (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgE (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgF (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgG (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgH (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgI (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivgJ (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkygptkpf