SCOPe 2.07: Domain d2ivgf2: 2ivg F:87-156

Lineage for d2ivgf2 (2ivg F:87-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
   active form is a decamer formed by five dimers

6. Protein automated matches [230795] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)

8. Domain d2ivgf2: 2ivg F:87-156 [230843]
   Other proteins in same PDB: d2ivga1, d2ivgb1, d2ivgc1, d2ivgd1, d2ivge1, d2ivgf1, d2ivgg1, d2ivgh1, d2ivgi1, d2ivgj1
   automated match to d1dwka2
   complexed with azi, cl, so4

Details for d2ivgf2

PDB Entry: 2ivg, 1.87 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (F:) cyanate lyase

SCOPe Domain Sequences for d2ivgf2:

Sequence; same for both SEQRES and ATOM records:

>d2ivgf2 d.72.1.1 (F:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkygptkpf

Timeline for d2ivgf2:

• d2ivgf2 first appeared in SCOPe 2.03
  
• d2ivgf2 appears in SCOPe 2.06
  
• d2ivgf2 appears in the current release, SCOPe 2.08