SCOPe 2.05: Domain d2ivbc1: 2ivb C:1-86

Lineage for d2ivbc1 (2ivb C:1-86)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
   probably does not bind to DNA

6. Protein automated matches [230792] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230793] (6 PDB entries)

8. Domain d2ivbc1: 2ivb C:1-86 [230816]
   Other proteins in same PDB: d2ivba2, d2ivbb2, d2ivbc2, d2ivbd2, d2ivbe2, d2ivbf2, d2ivbg2, d2ivbh2, d2ivbi2, d2ivbj2
   automated match to d1dwka1
   complexed with azi, cl, so4

Details for d2ivbc1

PDB Entry: 2ivb, 1.95 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (C:) cyanate hydratase

SCOPe Domain Sequences for d2ivbc1:

Sequence; same for both SEQRES and ATOM records:

>d2ivbc1 a.35.1.4 (C:1-86) automated matches {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

Timeline for d2ivbc1:

• d2ivbc1 first appeared in SCOPe 2.03
  
• d2ivbc1 appears in SCOPe 2.04
  
• d2ivbc1 appears in SCOPe 2.06
  
• d2ivbc1 appears in the current release, SCOPe 2.08