Lineage for d2ivbc2 (2ivb C:87-156)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913107Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 1913108Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 1913109Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 1913132Protein automated matches [230795] (1 species)
    not a true protein
  7. 1913133Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. 1913166Domain d2ivbc2: 2ivb C:87-156 [230817]
    Other proteins in same PDB: d2ivba1, d2ivbb1, d2ivbc1, d2ivbd1, d2ivbe1, d2ivbf1, d2ivbg1, d2ivbh1, d2ivbi1, d2ivbj1
    automated match to d1dwka2
    complexed with azi, cl, so4

Details for d2ivbc2

PDB Entry: 2ivb (more details), 1.95 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (C:) cyanate hydratase

SCOPe Domain Sequences for d2ivbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivbc2 d.72.1.1 (C:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiiaainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2ivbc2:

Click to download the PDB-style file with coordinates for d2ivbc2.
(The format of our PDB-style files is described here.)

Timeline for d2ivbc2: