Lineage for d2gdca2 (2gdc A:129-250)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313443Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2313444Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2313510Protein automated matches [226863] (2 species)
    not a true protein
  7. 2313511Species Chicken (Gallus gallus) [TaxId:9031] [225109] (3 PDB entries)
  8. 2313517Domain d2gdca2: 2gdc A:129-250 [230743]
    automated match to d1rkea2

Details for d2gdca2

PDB Entry: 2gdc (more details), 2.74 Å

PDB Description: Structure of Vinculin VD1 / IpaA560-633 complex
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d2gdca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdca2 a.24.9.1 (A:129-250) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsaeineiirvl
ql

SCOPe Domain Coordinates for d2gdca2:

Click to download the PDB-style file with coordinates for d2gdca2.
(The format of our PDB-style files is described here.)

Timeline for d2gdca2: