| Class b: All beta proteins [48724] (176 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein automated matches [190608] (3 species) not a true protein |
| Species Clostridium botulinum [TaxId:1491] [230685] (3 PDB entries) |
| Domain d2e4mb2: 2e4m B:149-286 [230689] automated match to d1qxma2 |
PDB Entry: 2e4m (more details), 1.85 Å
SCOPe Domain Sequences for d2e4mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e4mb2 b.42.2.1 (B:149-286) automated matches {Clostridium botulinum [TaxId: 1491]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwtieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqtangthv
ivdsyhgntnqqwiinli
Timeline for d2e4mb2: