Lineage for d2e4mb2 (2e4m B:149-286)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792240Protein automated matches [190608] (4 species)
    not a true protein
  7. 2792241Species Clostridium botulinum [TaxId:1491] [230685] (7 PDB entries)
  8. 2792257Domain d2e4mb2: 2e4m B:149-286 [230689]
    automated match to d1qxma2

Details for d2e4mb2

PDB Entry: 2e4m (more details), 1.85 Å

PDB Description: Crystal structure of hemagglutinin subcomponent complex (HA-33/HA-17) from Clostridium botulinum serotype D strain 4947
PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d2e4mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4mb2 b.42.2.1 (B:149-286) automated matches {Clostridium botulinum [TaxId: 1491]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwtieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqtangthv
ivdsyhgntnqqwiinli

SCOPe Domain Coordinates for d2e4mb2:

Click to download the PDB-style file with coordinates for d2e4mb2.
(The format of our PDB-style files is described here.)

Timeline for d2e4mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e4mb1