SCOPe 2.07: Domain d2cada2: 2cad A:61-146

Lineage for d2cada2 (2cad A:61-146)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d2cada2: 2cad A:61-146 [230611]
   Other proteins in same PDB: d2cada1, d2cadb1
   automated match to d2bj9a2
   complexed with cit, fmt, gol, ni

Details for d2cada2

PDB Entry: 2cad, 2.3 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 2f, 2x and 2i sites.

PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2cada2:

Sequence; same for both SEQRES and ATOM records:

>d2cada2 d.58.18.0 (A:61-146) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassfey

Timeline for d2cada2:

• d2cada2 first appeared in SCOPe 2.03
  
• d2cada2 appears in SCOPe 2.06
  
• d2cada2 appears in the current release, SCOPe 2.08