Lineage for d2cada2 (2cad A:61-146)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417150Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1417349Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 1417350Protein automated matches [226892] (4 species)
    not a true protein
  7. 1417360Species Helicobacter pylori [TaxId:85962] [230608] (7 PDB entries)
  8. 1417367Domain d2cada2: 2cad A:61-146 [230611]
    Other proteins in same PDB: d2cada1, d2cadb1
    automated match to d2bj9a2
    complexed with cit, fmt, gol, ni

Details for d2cada2

PDB Entry: 2cad (more details), 2.3 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 2f, 2x and 2i sites.
PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2cada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cada2 d.58.18.0 (A:61-146) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassfey

SCOPe Domain Coordinates for d2cada2:

Click to download the PDB-style file with coordinates for d2cada2.
(The format of our PDB-style files is described here.)

Timeline for d2cada2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cada1