![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries) |
![]() | Domain d1yq3b1: 1yq3 B:6-114 [230425] Other proteins in same PDB: d1yq3b2, d1yq3c_, d1yq3d_ automated match to d2bs2b2 complexed with f3s, fad, fes, gol, hem, jzr, pee, sf4, teo, unl, uq |
PDB Entry: 1yq3 (more details), 2.2 Å
SCOPe Domain Sequences for d1yq3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq3b1 d.15.4.2 (B:6-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
Timeline for d1yq3b1: