SCOPe 2.03: Domain d1yq3b1: 1yq3 B:6-114

Lineage for d1yq3b1 (1yq3 B:6-114)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (9 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [230424] (1 PDB entry)

8. Domain d1yq3b1: 1yq3 B:6-114 [230425]
   Other proteins in same PDB: d1yq3b2
   automated match to d2bs2b2
   complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq

Details for d1yq3b1

PDB Entry: 1yq3, 2.2 Å

PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone

PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d1yq3b1:

Sequence; same for both SEQRES and ATOM records:

>d1yq3b1 d.15.4.0 (B:6-114) automated matches {Gallus gallus [TaxId: 9031]}
aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc
regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

Timeline for d1yq3b1:

• d1yq3b1 is new in SCOPe 2.03-stable
  
• d1yq3b1 appears in SCOPe 2.04
  
• d1yq3b1 appears in the current release, SCOPe 2.08