Lineage for d1yq3c_ (1yq3 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577736Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2577828Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2577848Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2577928Protein automated matches [254461] (3 species)
    not a true protein
  7. 2577929Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries)
  8. 2577940Domain d1yq3c_: 1yq3 C: [238601]
    Other proteins in same PDB: d1yq3b1, d1yq3b2
    automated match to d1zoyc_
    complexed with f3s, fad, fes, gol, hem, jzr, pee, sf4, teo, unl, uq

Details for d1yq3c_

PDB Entry: 1yq3 (more details), 2.2 Å

PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone
PDB Compounds: (C:) Succinate dehydrogenase cytochrome B, large subunit

SCOPe Domain Sequences for d1yq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq3c_ f.21.2.2 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
attakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfslaal
llpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqveq
sgvvvliltllssagiaais

SCOPe Domain Coordinates for d1yq3c_:

Click to download the PDB-style file with coordinates for d1yq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1yq3c_: