| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Toxoplasma gondii [TaxId:5811] [230331] (2 PDB entries) |
| Domain d1sowb1: 1sow B:15-163 [230339] Other proteins in same PDB: d1sowa2, d1sowb2 automated match to d1pzga1 complexed with nad, oxl |
PDB Entry: 1sow (more details), 1.9 Å
SCOPe Domain Sequences for d1sowb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sowb1 c.2.1.0 (B:15-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm
Timeline for d1sowb1: