Lineage for d1sowb1 (1sow B:15-163)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1832398Species Toxoplasma gondii [TaxId:5811] [230331] (2 PDB entries)
  8. 1832402Domain d1sowb1: 1sow B:15-163 [230339]
    Other proteins in same PDB: d1sowa2, d1sowb2
    automated match to d1pzga1
    complexed with nad, oxl

Details for d1sowb1

PDB Entry: 1sow (more details), 1.9 Å

PDB Description: T. gondii bradyzoite-specific LDH (LDH2) in complex with NAD and oxalate
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sowb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sowb1 c.2.1.0 (B:15-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm

SCOPe Domain Coordinates for d1sowb1:

Click to download the PDB-style file with coordinates for d1sowb1.
(The format of our PDB-style files is described here.)

Timeline for d1sowb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sowb2