Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (26 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [230334] (2 PDB entries) |
Domain d1sowb2: 1sow B:164-331 [230340] Other proteins in same PDB: d1sowa1, d1sowb1 automated match to d1pzgc2 complexed with nad, oxl |
PDB Entry: 1sow (more details), 1.9 Å
SCOPe Domain Sequences for d1sowb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sowb2 d.162.1.0 (B:164-331) automated matches {Toxoplasma gondii [TaxId: 5811]} anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal
Timeline for d1sowb2: