SCOP 1.61: Domain d1occb1: 1occ B:91-227

Lineage for d1occb1 (1occ B:91-227)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)

8. Domain d1occb1: 1occ B:91-227 [23031]
   Other proteins in same PDB: d1occa1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occb1

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occb1:

Sequence; same for both SEQRES and ATOM records:

>d1occb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d1occb1:

• d1occb1 first appeared (with stable ids) in SCOP 1.55
  
• d1occb1 appears in SCOP 1.59
  
• d1occb1 appears in SCOP 1.63
  
• d1occb1 appears in the current release, SCOPe 2.08