Lineage for d1occb1 (1occ B:91-227)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11129Protein Cytochrome c oxidase [49544] (3 species)
  7. 11130Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 11135Domain d1occb1: 1occ B:91-227 [23031]
    Other proteins in same PDB: d1occa1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occb1

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:)

SCOP Domain Sequences for d1occb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1occb1:

Click to download the PDB-style file with coordinates for d1occb1.
(The format of our PDB-style files is described here.)

Timeline for d1occb1: