SCOPe 2.04: Domain d4nyoc_: 4nyo C:

Lineage for d4nyoc_ (4nyo C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries)
   Uniprot O58720

8. Domain d4nyoc_: 4nyo C: [230298]
   automated match to d1ukua_
   complexed with cl, mes, na, so4

Details for d4nyoc_

PDB Entry: 4nyo, 1.8 Å

PDB Description: The 1.8 Angstrom Crystal Structure of the Periplasmic Divalent Cation Tolerance Protein Cuta from Pyrococcus Horikoshii OT3

PDB Compounds: (C:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4nyoc_:

Sequence; same for both SEQRES and ATOM records:

>d4nyoc_ d.58.5.2 (C:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

Timeline for d4nyoc_:

• d4nyoc_ first appeared in SCOPe 2.03
  
• d4nyoc_ appears in SCOPe 2.05
  
• d4nyoc_ appears in the current release, SCOPe 2.08