PDB entry 4nyo

View 4nyo on RCSB PDB site
Description: The 1.8 Angstrom Crystal Structure of the Periplasmic Divalent Cation Tolerance Protein Cuta from Pyrococcus Horikoshii OT3
Class: metal binding protein
Keywords: Copper Tolerance, Cuta, Structural Genomics, Riken Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2013-12-11, released 2014-01-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyoa_
• Chain 'B':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyob_
• Chain 'C':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyoc_
• Chain 'D':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyod_
• Chain 'E':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyoe_
• Chain 'F':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.04: d4nyof_
• Heterogens: NA, CL, MES, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoA (A:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoB (B:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoC (C:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoD (D:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoE (E:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nyoF (F:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk