Lineage for d4n5zs1 (4n5z S:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775904Domain d4n5zs1: 4n5z S:11-324 [230284]
    Other proteins in same PDB: d4n5za2, d4n5zb1, d4n5zb2, d4n5zc2, d4n5zd1, d4n5zd2, d4n5ze2, d4n5zf1, d4n5zf2, d4n5zg2, d4n5zh1, d4n5zh2, d4n5zi2, d4n5zj1, d4n5zj2, d4n5zk2, d4n5zl1, d4n5zl2, d4n5zm2, d4n5zn1, d4n5zn2, d4n5zo2, d4n5zp1, d4n5zp2, d4n5zq2, d4n5zr1, d4n5zr2, d4n5zs2, d4n5zt1, d4n5zt2, d4n5zu2, d4n5zv1, d4n5zv2, d4n5zw2, d4n5zx1, d4n5zx2, d4n5zy2, d4n5zz1, d4n5zz2
    automated match to d4n5ze_
    complexed with nag; mutant

Details for d4n5zs1

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: crystal structure of aerosol transmissible influenza h5 hemagglutinin mutant (n158d, n224k, q226l and t318i) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (S:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4n5zs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zs1 b.19.1.2 (S:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4n5zs1:

Click to download the PDB-style file with coordinates for d4n5zs1.
(The format of our PDB-style files is described here.)

Timeline for d4n5zs1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n5zs2
View in 3D
Domains from other chains:
(mouse over for more information)
d4n5za1, d4n5za2, d4n5zb1, d4n5zb2, d4n5zc1, d4n5zc2, d4n5zd1, d4n5zd2, d4n5ze1, d4n5ze2, d4n5zf1, d4n5zf2, d4n5zg1, d4n5zg2, d4n5zh1, d4n5zh2, d4n5zi1, d4n5zi2, d4n5zj1, d4n5zj2, d4n5zk1, d4n5zk2, d4n5zl1, d4n5zl2, d4n5zm1, d4n5zm2, d4n5zn1, d4n5zn2, d4n5zo1, d4n5zo2, d4n5zp1, d4n5zp2, d4n5zq1, d4n5zq2, d4n5zr1, d4n5zr2, d4n5zt1, d4n5zt2, d4n5zu1, d4n5zu2, d4n5zv1, d4n5zv2, d4n5zw1, d4n5zw2, d4n5zx1, d4n5zx2, d4n5zy1, d4n5zy2, d4n5zz1, d4n5zz2