Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
Domain d4n5zf1: 4n5z F:1-174 [229157] Other proteins in same PDB: d4n5za1, d4n5za2, d4n5zb2, d4n5zc1, d4n5zc2, d4n5zd2, d4n5ze1, d4n5ze2, d4n5zf2, d4n5zg1, d4n5zg2, d4n5zh2, d4n5zi1, d4n5zi2, d4n5zj2, d4n5zk1, d4n5zk2, d4n5zl2, d4n5zm1, d4n5zm2, d4n5zn2, d4n5zo1, d4n5zo2, d4n5zp2, d4n5zq1, d4n5zq2, d4n5zr2, d4n5zs1, d4n5zs2, d4n5zt2, d4n5zu1, d4n5zu2, d4n5zv2, d4n5zw1, d4n5zw2, d4n5zx2, d4n5zy1, d4n5zy2, d4n5zz2 automated match to d2fk0b1 complexed with nag; mutant |
PDB Entry: 4n5z (more details), 2.95 Å
SCOPe Domain Sequences for d4n5zf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5zf1 h.3.1.1 (F:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis
Timeline for d4n5zf1:
View in 3D Domains from other chains: (mouse over for more information) d4n5za1, d4n5za2, d4n5zb1, d4n5zb2, d4n5zc1, d4n5zc2, d4n5zd1, d4n5zd2, d4n5ze1, d4n5ze2, d4n5zg1, d4n5zg2, d4n5zh1, d4n5zh2, d4n5zi1, d4n5zi2, d4n5zj1, d4n5zj2, d4n5zk1, d4n5zk2, d4n5zl1, d4n5zl2, d4n5zm1, d4n5zm2, d4n5zn1, d4n5zn2, d4n5zo1, d4n5zo2, d4n5zp1, d4n5zp2, d4n5zq1, d4n5zq2, d4n5zr1, d4n5zr2, d4n5zs1, d4n5zs2, d4n5zt1, d4n5zt2, d4n5zu1, d4n5zu2, d4n5zv1, d4n5zv2, d4n5zw1, d4n5zw2, d4n5zx1, d4n5zx2, d4n5zy1, d4n5zy2, d4n5zz1, d4n5zz2 |