Lineage for d4n5zp1 (4n5z P:1-174)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041326Domain d4n5zp1: 4n5z P:1-174 [229166]
    Other proteins in same PDB: d4n5za1, d4n5za2, d4n5zb2, d4n5zc1, d4n5zc2, d4n5zd2, d4n5ze1, d4n5ze2, d4n5zf2, d4n5zg1, d4n5zg2, d4n5zh2, d4n5zi1, d4n5zi2, d4n5zj2, d4n5zk1, d4n5zk2, d4n5zl2, d4n5zm1, d4n5zm2, d4n5zn2, d4n5zo1, d4n5zo2, d4n5zp2, d4n5zq1, d4n5zq2, d4n5zr2, d4n5zs1, d4n5zs2, d4n5zt2, d4n5zu1, d4n5zu2, d4n5zv2, d4n5zw1, d4n5zw2, d4n5zx2, d4n5zy1, d4n5zy2, d4n5zz2
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d4n5zp1

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: crystal structure of aerosol transmissible influenza h5 hemagglutinin mutant (n158d, n224k, q226l and t318i) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (P:) Hemagglutinin

SCOPe Domain Sequences for d4n5zp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zp1 h.3.1.1 (P:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d4n5zp1:

Click to download the PDB-style file with coordinates for d4n5zp1.
(The format of our PDB-style files is described here.)

Timeline for d4n5zp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n5zp2
View in 3D
Domains from other chains:
(mouse over for more information)
d4n5za1, d4n5za2, d4n5zb1, d4n5zb2, d4n5zc1, d4n5zc2, d4n5zd1, d4n5zd2, d4n5ze1, d4n5ze2, d4n5zf1, d4n5zf2, d4n5zg1, d4n5zg2, d4n5zh1, d4n5zh2, d4n5zi1, d4n5zi2, d4n5zj1, d4n5zj2, d4n5zk1, d4n5zk2, d4n5zl1, d4n5zl2, d4n5zm1, d4n5zm2, d4n5zn1, d4n5zn2, d4n5zo1, d4n5zo2, d4n5zq1, d4n5zq2, d4n5zr1, d4n5zr2, d4n5zs1, d4n5zs2, d4n5zt1, d4n5zt2, d4n5zu1, d4n5zu2, d4n5zv1, d4n5zv2, d4n5zw1, d4n5zw2, d4n5zx1, d4n5zx2, d4n5zy1, d4n5zy2, d4n5zz1, d4n5zz2